PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf10940g06011.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HSF
Protein Properties Length: 437aa    MW: 50846.9 Da    PI: 4.7235
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf10940g06011.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind83.53e-2639101264
                               HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE CS
              HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkk 64 
                               Fl+k+ye+++d+++++++sws+ +nsf+v+d+++fa ++Lp+yFkhsnf+SFvRQLn+Yg ++
  Niben101Scf10940g06011.1  39 FLTKTYELVDDANTNDIVSWSRGNNSFIVWDPQTFAMNLLPRYFKHSNFSSFVRQLNTYGLHE 101
                               9***********************************************************986 PP

2HSF_DNA-bind114.19.4e-361071992103
                               HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE---SSBTTTTXTTSEEEEESXX CS
              HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkvkdeekkskskekiweFkhksF 86 
                               Fl+k+ye+++d+++++++sws+ +nsf+v+d+++fa ++Lp+yFkhsnf+SFvRQLn+YgF+kv+ ++         weF+++ F
  Niben101Scf10940g06011.1 107 FLTKTYELVDDANTNDIVSWSRGNNSFIVWDPQTFAMNLLPRYFKHSNFSSFVRQLNTYGFRKVNPDQ---------WEFANEGF 182
                               9****************************************************************999.........******** PP

                               XXXXXXXXXXXXXXXXX CS
              HSF_DNA-bind  87 kkgkkellekikrkkse 103
                                +g+++ll+ i+r+k++
  Niben101Scf10940g06011.1 183 LRGQRHLLKAIRRRKTS 199
                               **************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.101.9E-2732100IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467856.94E-2434101IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004152.8E-2435102IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004471.6E-2139101IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene3DG3DSA:1.10.10.107.5E-38101191IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467851.9E-34102196IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004152.9E-59103196IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000565.6E-19107130IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004476.3E-31107196IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000565.6E-19145157IPR000232Heat shock factor (HSF)-type, DNA-binding
PROSITE patternPS004340146170IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000565.6E-19158170IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MDPNFAPTKE EVPGSSEASS FMWIPQPMEG LHENGPPPFL TKTYELVDDA NTNDIVSWSR  60
GNNSFIVWDP QTFAMNLLPR YFKHSNFSSF VRQLNTYGLH ENGPPPFLTK TYELVDDANT  120
NDIVSWSRGN NSFIVWDPQT FAMNLLPRYF KHSNFSSFVR QLNTYGFRKV NPDQWEFANE  180
GFLRGQRHLL KAIRRRKTSN FHPGQASNQG IDSYIELGKL EIDGEIDRLR REKQVLMMEL  240
VKLKQQQQTT KSHIKAMEEK LKRTEQKQQQ MMSFLAKAIQ NPRILEQMMQ QKERMKEQIE  300
DEIRKKRRRP IDQGPSNINV GVIELGHGVH DGNYNIKQEP QEYYGEIYGF DDFELERHVV  360
SMQGQSENTI SIEDYTIEKE DIGELEIHEN KAIDEGFWED LLDENVEDDI TLLGIEEEDE  420
DVDVLAQQLG FLGSTPK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ldu_A2e-243719918123Heat shock factor protein 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00371DAPTransfer from AT3G22830Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009797496.10.0PREDICTED: heat stress transcription factor A-6b-like
RefseqXP_009797497.10.0PREDICTED: heat stress transcription factor A-6b-like
SwissprotQ9LUH81e-120HFA6B_ARATH; Heat stress transcription factor A-6b
TrEMBLM1A7S21e-166M1A7S2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000165111e-166(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA57224113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22830.11e-107heat shock transcription factor A6B